PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009616490.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 293aa    MW: 32172.9 Da    PI: 8.4791
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009616490.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.69.2e-11856247
                     SSS-HHHHHHHHHHHHHTTTT....-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGgg....tWktIartmgkgRtlkqcksrwqky 47
                     + W+ eE++ + +a++ +  +    +W +Ia++++  +t +++k+++q +
   XP_009616490.1  8 LVWSREEEKAFENAIAIHWIEdsklQWQKIASMVP-SKTIEELKHHYQLL 56
                     57*****************99**************.***********965 PP

2Myb_DNA-binding38.33.1e-12132176347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ +  ++G+g+W++I+r     Rt+ q+ s+ qky
   XP_009616490.1 132 PWTEEEHRLFLLGLDKFGKGDWRSISRNYVISRTPTQVASHAQKY 176
                      7*****************************89************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.371560IPR017884SANT domain
SMARTSM007174.1E-6659IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-5956IPR009057Homeodomain-like
PfamPF002491.5E-7955IPR001005SANT/Myb domain
CDDcd001677.22E-91057No hitNo description
SuperFamilySSF466895.74E-91063IPR009057Homeodomain-like
PROSITE profilePS5129416.887125181IPR017930Myb domain
SuperFamilySSF466898.61E-17127182IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-17129179IPR006447Myb domain, plants
SMARTSM007174.7E-10129179IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-10130175IPR009057Homeodomain-like
CDDcd001671.29E-9132177No hitNo description
PfamPF002499.6E-11132176IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MSASTSSLVW SREEEKAFEN AIAIHWIEDS KLQWQKIASM VPSKTIEELK HHYQLLVDDV  60
TAIEAGNVPI PIYTGEETSS STKDSNHGYS GLSTGRSNCS YVNGFSASVH DQIGQGGKGS  120
SKSEQERRKG IPWTEEEHRL FLLGLDKFGK GDWRSISRNY VISRTPTQVA SHAQKYFIRL  180
NSMNRDRRRS SIHDITSVNN GEVATNQTPI TGQQTNPSPS NAVGPSVGQR NQPNMHGLGM  240
YGAPMGHPVA APPSSHVSAV GTPVMLPPGH HPHYVLPVGY HMPPHPPPPM HHQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00191DAPTransfer from AT1G49010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009616490.10.0PREDICTED: transcription factor DIVARICATA-like
TrEMBLM1A4211e-158M1A421_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000143501e-157(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA58012136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49010.12e-75MYB family protein